PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp5g02120
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family MYB
Protein Properties Length: 296aa    MW: 32787.1 Da    PI: 6.8551
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp5g02120genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.13.5e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+lv+++k+   g+W+t ++  g+ R++k+c++rw +yl
        Tp5g02120 14 KGPWTPEEDEILVEYIKKNSHGSWRTLPKNAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding53.94.1e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE++l v++++ lG++ W++Ia+ ++ gRt++++k+ w+++l
        Tp5g02120  67 RGPFTPEEEKLVVQLHAILGNR-WAAIAAQLP-GRTDNEIKNLWNTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.8E-24563IPR009057Homeodomain-like
PROSITE profilePS5129416.599961IPR017930Myb domain
SuperFamilySSF466893.59E-3011108IPR009057Homeodomain-like
SMARTSM007173.9E-131363IPR001005SANT/Myb domain
PfamPF002498.4E-151461IPR001005SANT/Myb domain
CDDcd001672.36E-101661No hitNo description
PROSITE profilePS5129426.10262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2664116IPR009057Homeodomain-like
SMARTSM007172.0E-1566114IPR001005SANT/Myb domain
PfamPF002496.7E-1667112IPR001005SANT/Myb domain
CDDcd001676.34E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009909Biological Processregulation of flower development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MGRTPCCDKK GLKKGPWTPE EDEILVEYIK KNSHGSWRTL PKNAGLLRCG KSCRLRWTNY  60
LRPDIKRGPF TPEEEKLVVQ LHAILGNRWA AIAAQLPGRT DNEIKNLWNT HLKKRLLSMG  120
LDPKTHEPLP SYGLAKQAPA SPTTRHMAQW ESARLEAEAR LSRESMLFNP TSGGGGKSDC  180
DHFLRIWNSE IGEAFRNLAP FDESITSQSP CSMTTSSSSA LPKSSTNSCV GREIVMEIHG  240
SDSSPCSNNL EDVSSDSALQ LLLDFPISDD DMSFLEENIG SYTESTVGVV SMVSKF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-29121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00114ampDAPTransfer from AT3G61250Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006402502.10.0hypothetical protein EUTSA_v10006126mg
TrEMBLV4L0Z80.0V4L0Z8_EUTSA; Uncharacterized protein
STRINGBra007588.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69822643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.11e-171myb domain protein 17